Skip to main content

Table 1 Differential peptide identified in LC-MS/MS analysis

From: Serum dihydroxyacetone kinase peptide m/z 520.3 as predictor of disease severity in patients with compensated chronic hepatitis B

  PA PA   Mean SPI (E + 05) p value Fold Differential peptide sequence IP GENE Protein Information
  Time(s) m/z MF SF   MF/SF   Tax Id = 9606   
1 2670 545.5 62.52 15.70 0.034 -3.22 AAGFLLMYST + Oxidation (M) IPI00644710 SLC35D2 Isoform2 of UDP-N-acetylglucosamine
2 2910 427.5 16.12 4.55 0.045 2.76 PTNFAPVINHVA IPI00334276 CPNE8 cDNA FLJ25727 fis,clone TST05479
3 3150 520.3 3.26 6.83 0.049 2.14 LLSKLSVLLLEKMG + Oxidation (M) IPI00551024 DAK ATP-dependent dihydroxyacetone kinase
4 2790 414.5 4.97 2.31 0.003 1.68 GPMNMNMGMNM + Oxidation (M) IPI00030652 ZIC2 Zinc finger protein ZIC 2
5 3390 640.5 22.93 7.92 0.025 2.26 AANSQPQPPRES IPI00221255 MYLK Isoform 2 of Myosin light chain kinase
6 3450 550.5 14.43 4.19 0.023 2.68 AAINKMCVFS + Oxidation (M) IPI00922072 - cDNA FLJ52618
7 4230 816.5 19.91 9.41 0.048 1.83 STPPITSSITPTDTMTSMRTTTS +2 Oxidation (M) IPI00386766 MUC3A Isoform 2 of Mucin-3A
8 2130 327.5 1.73 5.55 0.048 -4.11 MEGNKTWI IPI00455038 OR2A14 Olfactory receptor 2A14
9 2070 787.5 6.29 3.16 0.046 1.55 ELGLEMTAGFGLGGLRLTALQAQ + Oxidation (M) IPI00063762 HPDL 4 Hydroxyphenylpyruvate dioxygenase-like protein
10 2910 1013.5 4.04 7.45 0.044 -2.63 NYEESIKMPINEPAPGKKKSQIQEYV + Oxidation (M) IPI00218297 HPD 4 Hydroxyphenylpyruvate dioxygenase
11 3030 869.5 40.06 20.43 0.049 1.53 LPCTESSSSMPGLGMVPPPPPPLPGM + 2 Oxidation (M) IPI00742944 FMN2 FMN2 195 kDa protein
12 3390 881.5 10.90 4.28 0.031 1.99 MTCTYVCVCVYMYVCIYIYMY + Oxidation (M) IPI00943356 - Putative uncharacterized protein (Fragment)
13 3810 766.5 6.08 2.44 0.020 1.75 GTRRRCPCAPRSGLPGRRSVD IPI00936509 - LOC100287493; hypothetical protein
14 4230 839.5 10.26 4.01 0.035 2.21 EEPPPPSS IPI00386642 MEF2B LOC729991 Isoform 1 of UPF0402 protein
15 2070 682.5 24.48 51.19 0.048 -2.68 DQGLYHCIATEN IPI00019209 - SEMA3C cDNA FLJ55486
16 3270 1129.5 7.23 5.98 0.021 -5.32 CLSYMALLRLPKKRGTFIEFRNGMLNISP + Oxidation (M) IPI00294903 PMM1 Phosphomannomutase 1
17 3030 981.5 5.35 8.00 0.024 -1.92 NVARMLALALAESAQQAST + Oxidation (M) IPI00787743 ARHGAP32 Isoform 1 of Rho/Cdc42/Rac GTPase-activating protein
18 2790 757.5 71.50 30.99 0.049 1.8 DEPVSGELVSVAHALSLPAESY IPI00107104 CXorf26 UPF0368 protein Cxorf26
19 3150 1142.5 5.49 2.23 0.045 1.91 LTVLWYGVVHTSALVRCTAARMFELTLRGM + 2 Oxidation (M) IPI00101291 KIAA1468 KIAA1468, isoform CRA
20 3450 901.5 14.39 7.12 0.008 1.58 MPKTWISWAEIRSHTSSLSMSHP +2 Oxidation (M) IPI00643635 C20orf57 DUSP15 Dual specificity phosphatase 15
21 3930 857.5 15.45 5.17 0.036 2.33 AVNWVARSLYWTHTGTEHIEVT IPI00018681 LRP5L Isoform 2 of Low-density lipoprotein receptor-related protein 5-like protein